SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YIZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YIZ8
Domain Number 1 Region: 275-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-41
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 7-41
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000119
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YIZ8
Sequence length 471
Comment (tr|M3YIZ8|M3YIZ8_MUSPF) Tripartite motif containing 72 {ECO:0000313|Ensembl:ENSMPUP00000011305} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TRIM72 OC=Mustelinae; Mustela.
Sequence
MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLSPVATEPLRAPCREPPATQQTL
SFNFLAPRALGGWGKAPGEEEVAFLPHTPHTEPKRPSGSALYPSVGGHQAAFAFVALTKT
SAPQTQLPQQKLQLQEACMRKEKSAAVLEHQLLEVEETVRQFRGAVGDQLGKMRVFLAAL
EGSLDREAERVRSEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTS
RLQKILAESPPPARLDIQLPVISDDFKFQVWRKMFRALMPVTKDLTFDPSTAHPSLVLSP
SGRRVECSDQKAPPAGEDPCQFDKAVAVVARQLLSDGEHYWEVEVGDKPRWALGVIAAQA
SRRGRLHAVPSQGLWLIGLRDGKILEAHVEAKEPRALRPAERRPSRVGIYLSFADGVLSF
YDASDADALELLFAFHERLPGPVYPFFDVCWHDKGKNAQPLLLVGADGEEA
Download sequence
Identical sequences M3YIZ8
ENSMPUP00000011305 ENSMPUP00000011305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]