SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJ04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YJ04
Domain Number - Region: 72-124
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00769
Family Chromo barrel domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YJ04
Sequence length 270
Comment (tr|M3YJ04|M3YJ04_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000011311} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
VPESRVLKLMDNNLQKTTSNNLLEDCWSTAEEPGTGSPRQLGEPPILGSLRKTRKNKQKT
PGNGDGGSASKAPQPPQKKERKKERKGTKEGKKERKKENRMEVKVKIPEELKSWFVQDWD
LVTRKQLFQLPAKENADAILEEYANCKKLQGNVGNKEYVVNEVVARIKEYFNVMLGIQLL
HKFGRPHYEEILLACPDMPMSQVQGALHLQRLFVKIGAMLAYRPLDEKTLALLLGYSHDF
LKYLPRNATSLFTASDYKVASPPQSPVRVY
Download sequence
Identical sequences M3YJ04
ENSMPUP00000011311 ENSMPUP00000011311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]