SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJ28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJ28
Domain Number 1 Region: 495-835
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.18e-115
Family PDEase 0.00000026
Further Details:      
 
Domain Number 2 Region: 52-249
Classification Level Classification E-value
Superfamily GAF domain-like 1e-36
Family GAF domain 0.0003
Further Details:      
 
Domain Number 3 Region: 235-279,306-455
Classification Level Classification E-value
Superfamily GAF domain-like 1.69e-31
Family GAF domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YJ28
Sequence length 856
Comment (tr|M3YJ28|M3YJ28_MUSPF) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PDE6B OC=Mustelinae; Mustela.
Sequence
MSLSEEQVQQFLDQNPSFTDEYFGKKLSPENVAGACEDGQAADCTSFRELCQVEESAALF
ELVQDMQESVNMERVVFKILRRLCTILHADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNIKDVTECPHFSPFADELTDYVTKNILATPI
MNGKDVVAVIMAVNKLDGPCFTSEDEDVFLKYLNFGTLNLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGEAQPY
SGPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPADHWALASGLPTYVAESGFICNIMNA
PADEMFKFQEGPLDDSGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDKDEIQLILPTRERLGKEPADC
EEDELGTILKEVLPGPTKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSVSKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEESLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRTMFQKIVDESKNYEDRKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEQKQQQEEMTTAKKAGTE
ICNGGPAPKSSTCCIL
Download sequence
Identical sequences M3YJ28
ENSMPUP00000011335 XP_004772419.1.14098 ENSMPUP00000011335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]