SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJ54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJ54
Domain Number 1 Region: 149-217
Classification Level Classification E-value
Superfamily Homeodomain-like 2.87e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 56-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000143
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 24-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000214
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  M3YJ54
Domain Number - Region: 116-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0727
Family FwdE C-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YJ54
Sequence length 390
Comment (tr|M3YJ54|M3YJ54_MUSPF) LIM homeobox 4 {ECO:0000313|Ensembl:ENSMPUP00000011361} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LHX4 OC=Mustelinae; Mustela.
Sequence
MMQSAAVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMPLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLLEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKSAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRAGGKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGAPQSPSSVSSLPSHAPLLHGLDYMVDSNLGIIAHAGQGVSQTRRAMAGGPT
SDISTGSSVGYPDFPTSPASWLDEMDHPPF
Download sequence
Identical sequences M3YJ54
ENSMPUP00000011361 XP_004767949.1.14098 ENSMPUP00000011361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]