SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJ88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJ88
Domain Number 1 Region: 216-281
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000219
Further Details:      
 
Domain Number 2 Region: 284-322
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000011
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  M3YJ88
Domain Number - Region: 61-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.07
Family Chromo barrel domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YJ88
Sequence length 615
Comment (tr|M3YJ88|M3YJ88_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000011395} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPPVGYNKDIN
ESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKP
ATKDTFHKIKLDVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKR
AHMLIDMHFRSLRTKLSLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGAN
IQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKN
GKLIQEIVDKSGVVRVRIEAENEKSVPQEEEIMPPNSLPSSNSRVGPTPPEEKKHIDIKE
NSTHFSQPNSTKVQRVLVVSSIVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLDYH
LNYLKEVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRG
HGRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEERENFLRRGDGRRRGGGGRG
QGGRGRGGGFKGNDDHSRTDNRPRNPREAKGRTADGSLQNTSSEGNRLRTGKDRNQKKEK
PDNVDGQQPLVNGVP
Download sequence
Identical sequences M3YJ88
ENSMPUP00000011395 ENSMPUP00000011395 XP_004777991.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]