SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJ92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJ92
Domain Number 1 Region: 69-246
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.87e-33
Family APC10-like 0.0025
Further Details:      
 
Domain Number 2 Region: 1686-1745
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000153
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1643-1694
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000565
Family ZZ domain 0.02
Further Details:      
 
Weak hits

Sequence:  M3YJ92
Domain Number - Region: 950-1058
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00051
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 
Domain Number - Region: 2574-2663
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0484
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YJ92
Sequence length 2829
Comment (tr|M3YJ92|M3YJ92_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000011399} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MLEALKHSSGANLQGELSHTIRQLQACSLVPGFIDIFSESKEGLGVHASLILRFLHRNRL
SGTAVPCPMLDHCANVCAMRASVLKESLDQLLQREKESPGDLTGSPEMDKLKSVAKCYAY
IETSSNPADIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRHLSIAVAATDQSYMPQ
QVTVAVGRSASDLQDVRDVHIPSNVTGYVTLLENANISQLYVQINIKRCLSDGCDTRIHG
LRAVGFQRVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQTVLHNTQKALQHMPPL
SLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFALARGSVAKVLSSLCT
ISEHLDTQYDASSLIASMASVRQSLLLKYGKPLQLILQACDVKGKEEKSGPENLLVEPWT
RDGFLTETGKTRASTIFSTGTESAFQVTQIRIMVRRGGIGAQCGLVFAYNSSSDKFHAEE
HFKRFEKYDKWKLQEFRQFVKSRAGCPSEELGEDDPIGWFELEEEWDEADVKLRQCRVAQ
YLMVKFLCTRQESAERLGVQGLSISGYLRPVSAEAEQPAVCTLCRKDGEDSICGATLLLR
TLQFTQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQNPREECICAQTLLLR
LLQSCFSMLQRDGPAACPQAKAPRQSPAGAMAAKELHTHLCDVVDRVDGDSAPMETLKQE
VRNTLLNGAAVFFPDRQSRRDHLFAMMKHVTEQEHKQSLQLTFRSLCAYFSDKDPGGLLL
LPEKGDVADLNSPEVLAVTSTLLSVAARECELLVLTGAQGEAGSVLLSLFWAVQGSLLSW
CFLQLKSADPAARGRAADLLEQYVRQFLASLRVILESLLSQHSGKTIVEKLCNSVFSMAA
RQLVIFLLDFCALDIPHCTLLREFSTLTGLLRRLCADPEGLLDKLDAETWRQECPVVLHT
WTKESAHNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDYLEFTDARGGKTRYDTKV
GTEKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWALDLQLLVSRLM
GRLAAQGMALKSVHQFGSDMVVPPAKMASVLNSPLWKPVFRHQLSPELGLAASWPTPPHQ
DSKEVKNIPDDPCHHFLLEFAQSDPAQNFCGPFSELFKGFIQACRKQAPKTDIVAGSTID
QAVNATFAALVCRTPGLYEKLQKYVKSGGSTALSEEFAQVYCLADGIRIWMLEMKQKSLM
TLGDEAEGRRGSEAAEVNPEGLAKECIQKSLLLLRFLPVGVSSKESCDGLVAADETDHLQ
PRDRRPRTSSVVEEHFRASVSPVEVGTPAAGDGGPGSDVQPKLPPSSGPTAADLSSATTE
EPLSPSAPARRPPFARGRLRLLSFRSVEEARPAPTVKEKYPVLKDVLDFIKDQSLSHDSV
VKVLALRKAQAQSVLEVLRIIQYCLESLGQPHCFHPPYVLFLLELLTCQKEFTNYFVHLE
GCGARLHKEVRDTYYQFVLLLVEAVKGFHSIHDRSLLPALSCVQTALLHFLDMGWEPGDL
AFFVDIQLPHLLMKMSQENISVHDSVISQWSEDDELTDAKQNSEWMDECQDGMFEAWYEK
IAQEEPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQCSDMDLCKTCFLGGV
KPEGHGDDHEMVSMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYAAKKYSYGHLPTHSV
TAHPMVTIRISDRQRLIQPYVHNYAWLLFAALALYSAHLASGEDAAGERLGPREHSSASA
LRSQCLQLAGDCLMQAHQGKGLKTLCLLGILPDGESGPDRWAPPVTVPSRALEEDRAVRA
VEDPLHAGPSVLCHGKRDGPEEVGPLDSKQASKADEEGVSLAKGPLCQTQASNSPADGGT
APRRPDAENAGVLSQKPLEEKAVPASPEQVFAECSQKRILGLLAAMLPPLKLDPTVPVMP
LERVLPLMFQVVISNAGHLNETYHLTLGLLGQLIARLSPAEVDAAVVTVLSAEHALFASG
DSSVVPDGWKTTHLLFSLGAVCLDSRMGLDWACSMAEILRLLSSTPQWRDVIATFTDHCV
KQLPFQLKHTNVFTLLVLVGFPQVLCVGTRCVYMDNANEPHNVIVLKHFTEKNRAVIVDV
KTRKRKTVKDYQLVQKGQGCGGSQARLSQYAQHLAFIASHLLQTSVGSHCPEAVEATWVL
SLALKGLYKTLKAHGFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLLRDLEILSIMLYS
SKKESHTSAEHTALERDERGDPEDEVEGMVSSPTEPEQKKLDPLESLDEPTRICFLMAHD
ALRAPLHVLRAIYELQMKRTDSFFLEVQKRFDGDELTTDERIRTLAQRWQPSGGLRLEEQ
SAKAVDTDMIILPCLARPARCEQATAESNPVSQKLIASTESELRQSYAKQRRSKSAALLH
KELNSKSKRAARDYLFRVNEATAVLYARHVLASLLADWPGHVPVSEDTLELSGPAHMTYI
LDMFMQLEEKHQWEKILRKVLQGCRGSMLGTMALAACQFMEEPGMEVQVRESKHPYNNNT
NFEDKVHIPGAIYLSVKFDPQCSTEEGCDELAMASSSDFQQDRHTFSGSQQKWKDFELPG
DTLYYRFTSDMSNTEWGYKFTVTAGHLGRFQTGFEILKQMLSEERVVPHLPLAKIWEWLV
GVACRQTGHQRLKAIHLLLRIVRCCTHSDLCDLALLKPLWQLFTHMEYSRLEDVTQPGIL
LPLHRALTELFFVTENRAQELGLLQDYLLALTTDDHLLRCAAQALQNIAAISLAINYPNK
ATGLWNVEC
Download sequence
Identical sequences M3YJ92
ENSMPUP00000011399 ENSMPUP00000011399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]