SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJB6
Domain Number 1 Region: 29-169
Classification Level Classification E-value
Superfamily PX domain 0.00000000000818
Family PX domain 0.011
Further Details:      
 
Weak hits

Sequence:  M3YJB6
Domain Number - Region: 295-400
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.016
Family BAR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YJB6
Sequence length 407
Comment (tr|M3YJB6|M3YJB6_MUSPF) Sorting nexin {ECO:0000256|PIRNR:PIRNR036924} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SNX32 OC=Mustelinae; Mustela.
Sequence
LVGMPEFSNQQTSPPQQPSSVSVDLQGDSTLQVEISDAVSERDKVKFTVQTKSCLPHFAQ
TEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSITREE
FAKMKQELEAEYLALFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRK
ELLGGFLRNIVKSADEALITSMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMHSH
KCLADDFIPISAALNSLGTQEVNQLKTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRY
YMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRTAESHQQLCCQRFERLSDSA
KQELMDFKSRRVSSFRKNLIELAELELKHAKASTLLLRNTLIALKGE
Download sequence
Identical sequences M3YJB6
ENSMPUP00000011423 ENSMPUP00000011423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]