SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJN6
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.58e-41
Family VHS domain 0.00018
Further Details:      
 
Domain Number 2 Region: 175-230
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000551
Family SH3-domain 0.00057
Further Details:      
 
Weak hits

Sequence:  M3YJN6
Domain Number - Region: 287-358
Classification Level Classification E-value
Superfamily GAT-like domain 0.0154
Family GAT domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YJN6
Sequence length 520
Comment (tr|M3YJN6|M3YJN6_MUSPF) Signal transducing adaptor molecule {ECO:0000313|Ensembl:ENSMPUP00000011543} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=STAM OC=Mustelinae; Mustela.
Sequence
MNTAEDWGLILDICDKVGQSRTGPKDCLRSVMRRVNHKDPHVAMQALTLLGACVSNCGKI
FHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQG
VTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYP
STSNLITNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSKPHWYKDEKCRNLKCF
KIEFYYKEKINITCFIVKTEKKTVQFSDDVQVETIEPEPEQAFIDEDKMDQLLQMLQSTD
PSDDQPDLPELLHLEAICHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNED
PMYSMYAKLQNQQYYMQSSGVSGSQVYPGPPQSGTYLVAGSAQMSHLQSYSLPPEQLSSL
SQGAVPPSVNPALPSQQTQASYPNTMVSSVQGNTYPNQASVYSPPPAAAAATADVTIYQN
AGTNMSQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
Download sequence
Identical sequences M3YJN6
ENSMPUP00000011543 ENSMPUP00000011543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]