SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJP6
Domain Number 1 Region: 207-545
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.29e-102
Family Rap/Ran-GAP 0.000000817
Further Details:      
 
Domain Number 2 Region: 689-764
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000373
Family PDZ domain 0.011
Further Details:      
 
Weak hits

Sequence:  M3YJP6
Domain Number - Region: 928-1023
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000157
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YJP6
Sequence length 1044
Comment (tr|M3YJP6|M3YJP6_MUSPF) Signal-induced proliferation-associated 1 {ECO:0000313|Ensembl:ENSMPUP00000011553} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SIPA1 OC=Mustelinae; Mustela.
Sequence
MWAGGGVGSPRRGAAPAPTDDLFARKLRQPARPPLTPHTFEPRPARGPLLRSGSDAGEAR
PPTPASPRARAHSHEEASRPAAGPTRLFTDPLALLGLPAEEPEPAFPPVPEPHWFAHYDV
QSLLFDWAPKPRGTGGHAEATSGTPASAEDRSAGSDLLLEAPGFVSELGGEGELGLGGPV
PPPVPPALPNAAVSVLEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGLDEVLGPV
AVSLRREEKESSGGGTLHSYRIIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVAP
WLSPTCLRLGSASPKVPRTLLTLDEQVLSFQRKVGVLYCRAGQASEEDMYNNREAGPAFM
QFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQ
LLRKRHIGNDIVTIVFQEPGSKPFSPTTIRSHFQHVFLVVRADAPCTPHTSYRVAVSRTQ
DTPAFGPALPPGGGPFEANSDFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLAT
NEVTTTSLDSASRFGLPSLGGRRRAPPRGPGAELQAAGALVWGVRAAPGARGAAGAGVEA
GGPDDAEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQRLDLYYGRGEAITL
RFDGSPGQAVGEVVARLQLVSRGCESRELALPRDGQGRLGFEVDAEGFITHVERFTFAET
AGLRPGARLLRVCGQTLPTLGSEAAAQLLCSAPKVCVTVLPPDESGRPRRSFSELYTLSL
QEPSRRGPPEPVQEEAPGVVTLLPTTKQLLQLCLHDGGSPTGPGDLAEERTEFLHSQHSP
SPRSSLSDEAPVLPNTTPDLLLATTAKPAAPSTGRQTPPTQDGPSSPTGGEDRVDPAPEL
RASFLPRTLSLRNSISKIMSEAGSETLEDEWQSISEIASTCNTILQSLSREGQPIPENGD
GKGMPKADAEPEPGSLSEKVSHLEATLRKLQEDLEKERADRAALEEEVRSLRHNNRRLQA
ESESAANRLLLASKQLGTPTTDLD
Download sequence
Identical sequences M3YJP6
ENSMPUP00000011553 ENSMPUP00000011553 XP_004770093.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]