SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YJZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YJZ2
Domain Number 1 Region: 442-522
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.35e-26
Family PB1 domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 552-610
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-20
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 100-239
Classification Level Classification E-value
Superfamily TPR-like 2.45e-19
Family Tetratricopeptide repeat (TPR) 0.000000282
Further Details:      
 
Domain Number 4 Region: 326-412
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-18
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YJZ2
Sequence length 620
Comment (tr|M3YJZ2|M3YJZ2_MUSPF) Neutrophil cytosolic factor 2 {ECO:0000313|Ensembl:ENSMPUP00000011649} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NCF2 OC=Mustelinae; Mustela.
Sequence
MGQRRTVVPMLLDWLILVQSSSLLLLPMPSGRASLGCASVAERWGHFLSLCNTETLLDPI
RSAAPGKCHPGAGDPCSPSLWVLAASRAPGLCLTMSLAEAISLWNEGVLAADKKDWKGAL
DAFTAVQDPHSRICFNIGCVHTILENMPEAEKAFTKSINRDKHLAVAYFQRGMLYYHMEK
YDAAIKDLKEALTQLRGNQLIDYKILGLQFKLFACEVLYNVALMHAKKEEWKQAEEHLAL
AMSMKSEQRHTKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVA
SVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETSEELQVMPGNI
VFVLKKGNDNWATVIFNGQKGLVPCNYLEPVELRIPGQQQPQEEASPESDIPAPPSSSAP
GRPHLPPGQKGKEEPKEGKLSVPMPYTLKVHYKYTVVMETQPGLPYSQVRDMVSKKLELL
PEHTKLSYRPLDSNELVPLSEENMKAAWGQVKNFSLTLWCENTVGDQGFPDEPKESEKSE
ANNQTTELELKEGGQVVALFSYEATQPEDLEFQEGDIIRIISMVNEDWLEGECKGKTGIF
PKAFVEEHAATDLESSPRGV
Download sequence
Identical sequences M3YJZ2
ENSMPUP00000011649 ENSMPUP00000011649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]