SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YK28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YK28
Domain Number 1 Region: 320-529
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.64e-51
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 181-317
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 9.29e-41
Family Domain of poly(ADP-ribose) polymerase 0.00014
Further Details:      
 
Domain Number 3 Region: 39-153
Classification Level Classification E-value
Superfamily WGR domain-like 2.35e-35
Family WGR domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YK28
Sequence length 531
Comment (tr|M3YK28|M3YK28_MUSPF) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PARP3 OC=Mustelinae; Mustela.
Sequence
MAPKRKSQVPHEGPDKKQGRQGAEEEDNFRSTAEALRAAPTEKHTVRVDPACPLSHSPRT
QVHEDYACTLNQTNIGSNNNKFYIIQLLEEGDRFACWNRWGRVGEVGQSKLSYFKLLEDA
KKDFEKKFRDKTKNSWAERDHFVAHPGKYTLIEVQGDDEAQEAVVKVDGGPVRSVVQRVR
PCSLDAATQKLITNIFSKDMFKNAMTLMNLDVKKMPLGKLSKQQIARGFEALEALEAALR
APADGGLSLEELSSHFYTVIPHNFGRNRPPPINSPELLQAKKDMLLVLADIELAQTLQAT
PEEEKVEEVPHPLDRDYHLLKCQLELLDPKAPEYKVIRTYLEQTGNSYRCPALQHVWKVN
REGEGDRFQAHSKLGNRKLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKS
ASYVTGMSCGAHQLGYMFLGEVALGREHHITVDDPSLKQPPPGFDSVIARGHTEPDPTQD
TELELDGQRVVVPQGRPVLCAEFSSSRFSQSEYLIYQDSQCHLRYLLEVHL
Download sequence
Identical sequences M3YK28
ENSMPUP00000011685 XP_004780143.1.14098 XP_012905214.1.14098 XP_012905215.1.14098 XP_012905216.1.14098 XP_012905217.1.14098 XP_012905218.1.14098 ENSMPUP00000011685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]