SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YK81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YK81
Domain Number 1 Region: 114-378
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-76
Family Protein kinases, catalytic subunit 0.0000154
Further Details:      
 
Domain Number 2 Region: 38-110
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-20
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YK81
Sequence length 863
Comment (tr|M3YK81|M3YK81_MUSPF) Mitogen-activated protein kinase kinase kinase {ECO:0000256|PIRNR:PIRNR000556} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MAP3K11 OC=Mustelinae; Mustela.
Sequence
MEPLKNLFLKSPLGSWNGSGGGGGGGGGSGVWPEGSPKTAAYANPVWTALFDYEPNGQDE
LALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRL
EEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIAL
KAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIH
RDLKSNNILLLQPIEGDDMDHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTF
SKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCW
AQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLS
REEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFK
RSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPAE
PGQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRLDEATWYLDSDDSSS
LGSPSTPPMLNGNPQRPSPEPEEPRRTGPVERGSGSGTPKLIQRALLRGTALLASLGLGR
DLQTPPPPGGPGRERGETPPPTPRALPTVSPAEPPPSQPIRFSPKTLDVPASLLTPEAPG
PPAPAPLLLELGVPVGQLSAKSPRRHDEERRGSTVSPPPGISRSAPGTPGTPRSPPLGLI
SRPRPSPLRSRIDPWSFVSAGPRPSPLSSPQPAPRRAPWTLFPDSDPFWDSPPANPFRGG
PQDCRAQTKDIGAQAPWAPEAGP
Download sequence
Identical sequences M3YK81
ENSMPUP00000011738 ENSMPUP00000011738 XP_004770094.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]