SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YKF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKF0
Domain Number 1 Region: 142-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-50
Family Nucleotide and nucleoside kinases 0.0000000171
Further Details:      
 
Domain Number 2 Region: 2-67,106-141
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-24
Family SH3-domain 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YKF0
Sequence length 523
Comment (tr|M3YKF0|M3YKF0_MUSPF) Calcium voltage-gated channel auxiliary subunit beta 2 {ECO:0000313|Ensembl:ENSMPUP00000011807} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CACNB2 OC=Mustelinae; Mustela.
Sequence
MAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYS
SKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAEGNDIQANHRSPKPSANSVTSPH
SKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIS
ITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADT
INHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELF
DVILDENQLEDACEHLADYLEAYWKATHPPSSHLPNPLLSRTLATSALPSSPTQASNSQG
SQGDQRTERSAPARSASQPEEEPCPEPVKKPQHRSSSSAQHHSHRSGTSRGLSRQETFDS
ETQESRDSAYVEPKEDYSHEHVDHYAPHRDHNHREEPHGSSEHRHRESRHRSRDLDREQD
HNECNKQRSRHKSKDRYCDKDGEGLSKKRNEAGEWNRDVYIRQ
Download sequence
Identical sequences M3YKF0
ENSMPUP00000011807 ENSMPUP00000011807 XP_012914350.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]