SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YKI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YKI6
Domain Number - Region: 42-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YKI6
Sequence length 199
Comment (tr|M3YKI6|M3YKI6_MUSPF) Sjogren syndrome/scleroderma autoantigen 1 {ECO:0000313|Ensembl:ENSMPUP00000011843} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SSSCA1 OC=Mustelinae; Mustela.
Sequence
MALNGAEADDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPSGSRPAPQPPVP
RPEHCEGAAAGLKAAQGPPPPVVPPNADVLACTQEALLQKLTWASAELGPSTSLETSIQL
CSLIRACAEALRSLRQLQH
Download sequence
Identical sequences M3YKI6
ENSMPUP00000011843 ENSMPUP00000011843 XP_004770098.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]