SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YKI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKI9
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-80
Family IMD domain 0.00000000148
Further Details:      
 
Domain Number 2 Region: 355-417
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000101
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YKI9
Sequence length 500
Comment (tr|M3YKI9|M3YKI9_MUSPF) BAI1-associated protein 2 {ECO:0000313|EMBL:AER94926.1, ECO:0000313|Ensembl:ENSMPUP00000011846} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BAIAP2 OC=Mustelinae; Mustela.
Sequence
MEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMA
EVHRQIQNQLEEMLKSFHNELLTQLEQKVELDARYLSAALKKYQTEQRSKGDALDKCQAE
LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEK
QCAVAKNSAAYHSKGKELLAQKLPLWQQACADPNKIPERAVQLMQQVPSNGSVLPSALSA
SKSSLVISDPIPGAKPLPVPPELAPFVGRLSAQESAPAMNGVSGPDGEDYSPWADRKAAQ
PKTSSPPQSQSKLSDSYSNTLPVRKSVAPKNSYAATENKTLPRSSSMAAGLERNGRMRVK
AIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGS
DRLHMSLQQGKSSSTGNLLDKEELALPPPDYNASSRAFPAQTAGTFKQRPYSVAVPAFSQ
GLDDYGARAVSSADVDVARL
Download sequence
Identical sequences M3YKI9
ENSMPUP00000011846 ENSMPUP00000011846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]