SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YKJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKJ6
Domain Number 1 Region: 936-1018
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-20
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YKJ6
Sequence length 1019
Comment (tr|M3YKJ6|M3YKJ6_MUSPF) Nebulette {ECO:0000313|Ensembl:ENSMPUP00000011853} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NEBL OC=Mustelinae; Mustela.
Sequence
MRVLVFEDVKDEAEEGKTEEEEDEDDTVFFKPVIEDLRMELARKCTKLISDIHYKEEYKK
SKDKCTSVTDTPMLNHVKNIGAFISEAKYKGTIKANLSNSLYKQMPATIDSVFAREVTHL
QSEVAYKQKHDAARGFSDYAHMKEPPDVRHAMEVNKHQSNISYRKDVQDAHTYSADLNRP
DIKMATQLSKLISNAEYKKGQGVMNKEPAVLGRPDFEHAVEASKLSSQVKYKEKFDNEMK
DKKHHYNPLESASFRQSQLATALVSDVKYKKDIQSMHEPVSGLPNLFLEHALKTSKMLSG
HEYRKLFEENKGMYHFDADAAEHLHHKGNAMLQSQVKYKEEYEKNKGKSMLEFVETPSYQ
ASKEAQKMRSEFDLYKQSFSFSLKTAGKLVLSATQEDIFLKYGTNMVPNILEKEYKKDLE
NEIRGKGMELNPDVLDIQRAKRASEMASEKEYKKDLESKIKGKGMQVGTDTLQIQHAKKA
AEIASQKDYKKDLETEIRGKGMQVGPDTPDIQRAKKASEMASQKEYKKDLENEIKGKGMQ
VSMDILDILRAKRASEIYSQKKYKDEAEKMLSNYSSVLDTPEIQRIKITQQNISAIFYKK
EIGAGTAVKDTPETERVKKNQQNISSVKYKEEMHQATAISDPPELKRAKENQKNISNLQY
KQQCPKATPVSVTPEMERVRRNQEELSTVKYKGETKQATAISDPPELKRVKENQKNISNV
HYKGQLGRATALSITPEMERVKKNQENISSVKYTQDHKQMKGRPSLILDTPGLRYVKEAQ
NHISMVKYHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGI
IVVKDLKVWRTDPGSIFDLDPLEDNIQSRSLHMLSEKANHYRRLRSRSHSSSTFGTGLGD
DKSEISEIYPSFSCCSEVTRPSDEGAPVLPGAYQQSHSQGYGYMHQTSLSSMRSMQHSPN
LRTYRAMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGKTGMLPANYIEFVN
Download sequence
Identical sequences M3YKJ6
ENSMPUP00000011853 ENSMPUP00000011853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]