SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YKT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKT4
Domain Number 1 Region: 31-173,205-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.4e-59
Family BAR domain 0.00000648
Further Details:      
 
Domain Number 2 Region: 516-592
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-19
Family SH3-domain 0.00000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YKT4
Sequence length 594
Comment (tr|M3YKT4|M3YKT4_MUSPF) Bridging integrator 1 {ECO:0000313|Ensembl:ENSMPUP00000011941} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BIN1 OC=Mustelinae; Mustela.
Sequence
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWLDYHQKLVD
QALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEK
AAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVN
TFQSIAGLEENFHKEMSKLNESLNDVLVSLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPP
PEGSPAATPEIRVNHEPEPPSSATAGASLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQIL
SLFDDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVASPVKAPTPSGQSIPWDL
WEPTESPAGSLPSREPSAAEGTFAVAWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGE
TAASEAASSSLPAVVVETFSATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYVATDTDEL
QLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVQ
Download sequence
Identical sequences M3YKT4
XP_004777855.1.14098 ENSMPUP00000011941 ENSMPUP00000011941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]