SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YKY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKY0
Domain Number 1 Region: 400-447,504-703
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4e-77
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000856
Further Details:      
 
Domain Number 2 Region: 27-131
Classification Level Classification E-value
Superfamily BRCT domain 1.57e-21
Family DNA ligase 0.059
Further Details:      
 
Domain Number 3 Region: 708-822
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 1.79e-16
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YKY0
Sequence length 1254
Comment (tr|M3YKY0|M3YKY0_MUSPF) DNA repair protein REV1 {ECO:0000256|PIRNR:PIRNR036573} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=REV1 OC=Mustelinae; Mustela.
Sequence
MRRGGWRKRAENDGWEKWGGYMAAKVQKLEEQFRSDATLQKDGTSSTIFSGVAIYVNGYT
DPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKA
GRLLSCIPYQLYSKQSSMQKGLNFTPACKAEEPGPGPSSVVKQLNNRVNHIIKKIETENE
VKVNGMNSWNEEDANNDFNFMELEQIFPGRKQNGIPHHRDNTAIFNGHTPSSNGALKTQD
CLVPMGHSIASRLSPDFAQGEEQAEKSSTDFRDCVVHLSQQSTRNTDAVRNPHRTNSFSL
SSLHSNTKVNGAHHSAVQGPSSTKSTSSIPTLSKAAPSVPSKPSDCGFISDFYSRSRLHH
ISMWKCELTEFVSALQRQSSGVFPGREKLKKMKTGRSALVVTDTGNMSVLSSPRHQSCIM
HVDMDCFFVSVGIRNRPDLKGKPVAVTSNRGTGRAPLRPGANPQLEWQYYQNKILKGKAA
EIPDSSLWENQDSAQANGIDSVLSKAEIASCSYEARQVGIRNGMFFGQAKQLCPSLQAVP
YDFHAYKEVARTMYETLASYTHNIEAVSCDEALVDITEILAETRLTPDEFANAVRMEIKD
QTKCAASVGIGSNILLARMATRKAKPDGQYHLKPEEVDDFIRGQLVSNLPGVGRSMESKL
TSLGIKTCGDLQYMTMAKLQKEFGPKTGQMLYRFCRGLDDRPVRTEKERKSISAEINYGI
RFTQPKEAEAFLLNLSEEIQRRLEAAGMKGKRLTLKVMVRKPGAPVETAKFGGHGICDNI
TRTVTLDQATDSAKIIGKATLNMFHTMKLNISDMRGVGIQVNQLVPINPNPSACPSRPSV
QSSHFPGGSHSVLDLFQVQKAKKSIEEEHKEVFVAAMDLEISSASRNCTFMPSFSTHLTS
SVNPVTSKAESSGKWNGLHSPISLKSRLNLSIEVPSPSQLDQSVLEALPPDLREQIEQAC
AGQQGEQHGDKRKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDAGISVIALPAFSQVDP
EVFAALPAELQKELNAAYDQRQRQGENAAHQQLATASVPKNLLRQLKPAAVKEKKRNKKK
NPISSPKKIQSPLKNKLLTSPVKTLPGACGSPQKLIDGFLKHEGPASEKPLGELSASTSG
VPGLSSLQPEPAACRRPPAPNLAGAVEFSDVKTLLKEWITTISDPMEEDILQVVKYCTDL
IEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Download sequence
Identical sequences M3YKY0
ENSMPUP00000011987 ENSMPUP00000011987 XP_004753073.1.14098 XP_004753074.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]