SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YL08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YL08
Domain Number 1 Region: 383-522
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 3.84e-45
Family gamma-adaptin C-terminal appendage domain-like 0.0000089
Further Details:      
 
Domain Number 2 Region: 102-230
Classification Level Classification E-value
Superfamily GAT-like domain 1.02e-36
Family GAT domain 0.0000102
Further Details:      
 
Domain Number 3 Region: 1-86
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.35e-23
Family VHS domain 0.00000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YL08
Sequence length 526
Comment (tr|M3YL08|M3YL08_MUSPF) Golgi associated, gamma adaptin ear containing, ARF binding protein 2 {ECO:0000313|Ensembl:ENSMPUP00000012015} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GGA2 OC=Mustelinae; Mustela.
Sequence
MCVNHCGEKFHNEVAKFRFLNELIKVLSPKYLGSWTTEKVKGRVLEILFSWTVWFPEDVK
IRDAYQMLKKQGIVKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDL
QAANRLIKNLVKEEQEKTEKVSKRVSAVEEVRSHVKVLQEMLSVYRRPGQAPPDQEALQV
VYERCEKLRPTLFRLASETTDDDDALAEILQANDLLTQGVLLYKQVMEGRVIFGNTVTSA
VGDLAVSTVFQKPAGCTKSCPLIDLEVDSGSEQAGTAAPSLLHQDLAALGLGDAPVTNKV
AGQNCCKEKKNPPASMLPGGDVQSPSAERNLLDLLSPQPCPGPLNYVPQKSIPKEVPPGT
KSSPGWSWEAGPLASSPSTQNTSLAQVFVPLESVKPSSLPPLIVYDRNGFRILLHFSQTG
APGHPEVQVLLLTMMSTATQPVWDIMFQVAVPKSMRVKLQPASSSKLPAFSPLTPPAVIS
QMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAVLGAA
Download sequence
Identical sequences M3YL08
ENSMPUP00000012015 ENSMPUP00000012015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]