SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YL30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YL30
Domain Number 1 Region: 804-1098
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-68
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000313
Further Details:      
 
Weak hits

Sequence:  M3YL30
Domain Number - Region: 466-652
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0103
Family BAR domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YL30
Sequence length 1274
Comment (tr|M3YL30|M3YL30_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000012037} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
QNAVRVPRDFEGCSVLRKYLGQLHCLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKY
EQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLCEHFPQAYSVDMSRQ
ILSLNVNLMLGQAQECLLEKSMLDNRKSFLQARISAQVVDYYKEACRALENPDTASLLGR
IQKDWKKLVQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPD
TVQDALRFAMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVT
GPDIFAKLVPMAAHEASSLYSEEKAKLLWEMMAKIEDQNEVLDQFMDSMQLDPETVDNLD
AYNHIPPQLMEKCAALSVRPDTVRNLVQSMQALSGVFTDVEASLKDIRELLEEDELLEQK
LQEALGQAGASPAGSKAELAEVRRDWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGP
LDQVRAALPTPALTPEDKAVLQNLKRILAKVQEMQDQRVSLEQQLRELIQKDDITASLVT
ADHSEMKKLFEEQLKKYDQLRVYLEQNLAAQDNVLRALTEANVQYAAVRQVLSELDQKWN
STLQTLVASYEAYEDLMKKSQEGKDFYADLESKVAALLERAQSTCQAREAXTPPLHTPLY
PGPSQDPLPPHSGALPFPTPGPPQSPHPTLAYGPAPSPRPLGPQAAPLSIRGPSPAGQPT
PNPHLVPSPAPSPGPGRVPPRSPAAEPPPSARRGTAAADLLSSSPESQHGGTQPPGGGQP
LLQPTKVDTAEGRGPQALRLIERDPYEHPERLQQLQRELEAFRGQLGDAAALDAMWRELQ
DAQEHDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLHLGKDDYINASCVEGLSPYCPPL
VATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKFLQQKVARYFPTERGQPMVHGAL
SLALSSVRATETHVERVLSLQFRDQSLKRSLLHLHFPTWPELGLRDSPGNLLRFIQEVHA
HYLHQRPLHTPVVVHCSSGVGRTGAFALLYAAVQEVEAGNGIPELPRLVRRMRQQRKHML
QEKLHLRFCHEAVVRPVEQVLQRHGVPPPGRPSAGTSVSQKNHLPQDSQDLVLGGDMPIS
SIQATIAKLSIRPPGALDSPAASIPGPVEPPGLPPASLPESTQLPPSSPPPLSSPQPEAP
QPEEEQPVPEAPSLGPPSSSLELLASLTPEAFSLDRKQRMSKQNFLQAHNGQGLRAARAT
DDPLSLLDPLWTLN
Download sequence
Identical sequences M3YL30
ENSMPUP00000012037 ENSMPUP00000012037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]