SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YL89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YL89
Domain Number 1 Region: 184-386
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-53
Family DBL homology domain (DH-domain) 0.00000155
Further Details:      
 
Domain Number 2 Region: 373-535
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-34
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 653-754,802-828
Classification Level Classification E-value
Superfamily SH2 domain 1.84e-24
Family SH2 domain 0.00097
Further Details:      
 
Domain Number 4 Region: 557-646
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-16
Family SH3-domain 0.001
Further Details:      
 
Domain Number 5 Region: 61-208
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000054
Family Calponin-homology domain, CH-domain 0.034
Further Details:      
 
Domain Number 6 Region: 763-816
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000144
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YL89
Sequence length 834
Comment (tr|M3YL89|M3YL89_MUSPF) Vav guanine nucleotide exchange factor 2 {ECO:0000313|Ensembl:ENSMPUP00000012096} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=VAV2 OC=Mustelinae; Mustela.
Sequence
MAGVAGVPAELGPSPSSPPGSLICHCHACPLRLSAISRVPRWRLSPCPDRCEISVGLGAS
QGQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHHVAQNKG
IRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVRQPMK
MGMSEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMTPLRQVLSPADVTAIFINLEDLIKV
HHSFLRAIDVSMMAGGSTLAKVFLDFKERLLIYGDYCSHMEHAQNTLNQLLAGREDVRQK
VEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLREALEAMQDLA
MYINEVKRDKETLKKISEFQSSIENLQVKLEEYGRPKIDGELKVRSIVNHTKQDRYLFLF
DKVVIVCKRRGYSYELKEVIELLFHKMTDDPTNNKDVKKWSYGFYLIHLQGKQGFQFFCK
TEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACRMFLRGTFYQGYLCT
RCGVGAHKECLEVTPPCKISSPADLDASGAGPGPKMVAVQNYHGNPAPPGKPVLTFQTGD
VIELLRGDPESQWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVSRPPSRDIDYSAYPWFA
GNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFHDEVKHIKVVEKDSWVHITEAK
KFENLLELVEYYQCHSLKESFKQLDTTLKYPYKSKERAASRASSRSPVFTPRVIGTAVAR
YNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGEANGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences M3YL89
ENSMPUP00000012096 ENSMPUP00000012096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]