SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YLA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YLA5
Domain Number 1 Region: 16-113
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-19
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 
Domain Number 2 Region: 581-662
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000128
Family PDZ domain 0.027
Further Details:      
 
Domain Number 3 Region: 856-997
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000531
Family Nucleotide and nucleoside kinases 0.0044
Further Details:      
 
Weak hits

Sequence:  M3YLA5
Domain Number - Region: 677-736
Classification Level Classification E-value
Superfamily SH3-domain 0.0016
Family SH3-domain 0.0049
Further Details:      
 
Domain Number - Region: 309-379
Classification Level Classification E-value
Superfamily ImpE-like 0.0327
Family ImpE-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YLA5
Sequence length 1002
Comment (tr|M3YLA5|M3YLA5_MUSPF) Caspase recruitment domain family member 14 {ECO:0000313|Ensembl:ENSMPUP00000012112} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CARD14 OC=Mustelinae; Mustela.
Sequence
MAMLRRTESTLTALDEDALWELLESHRHKIVRSICPSRLTPYLRQAKVLDQLDEEEVLHG
PRFTNTVMRVGHLLDLLKTRGKNGAIAFLESLKFHNPDIYTLVTGLQPKGDFSNFSGLMD
TSKLTECLAGAISSLQEELSQEKGQKEALLRRCQQLQEHLGQAEARVQSLGQMEADHDRM
KREVSAYFHEVLKLKDEMLGLSLHYSNALREKELAATRCRSLQEELYLTKQELQREKMSS
CHARELRERSPQTAGDGDLEPGDKALSRLKEENEKLRSLTFSLAEKDILEQNLDEALESK
QELVDRIHSLRERAVAAERQRKQYWEEKEQTLLQFQRTKVDCDIYKEKVNALQGQLQQLQ
KERDQAYSARDAAQTEISQNLTEKDALRREVFELTDQVCELRQQLRRPAESPQGAEQEAG
ARAPGLRGKQPLVRMFAICPRDDSDNSSPSSTELCSDLNATCTRELVDSFRSSSPLPPSP
QSLYKRAAEDFREDSWSLSGFLEIRQVDRGLSRGVKAGDADLDYEIVDRADLPECENSLQ
PCAGDLTASSSSVPVRRRQARKILSQVTVLAFQGDALLEQISIIGGNRTGIFIHRVTPGS
PADEMALRPGTQIMLVDYEAAEPSFKATLEDTTLEQAVRLLQRVNGFCCLSVKVNMEGYR
RLVQDLEANVVTSGDSFYIRVNLAMEARAEGELAVRCGDVLHVSDTLFQGRGCWRAHRVG
PYSTKGVEHGTIPNYARAQQLLIALIQDMAQQSTAGRKRSSGGPQKLVRIVSVDRTKASP
LRSSFDGALWEPSKLEEPSIACFWAESCFTLVPYTLVHPHRPSQPRPVILVPRVVGKILS
EKLCLLQGFKKCPAEYLSQEEYNASSQRGDIIQEREASGGHFCVTRQAVESLMEKNTHAL
LDVRLDSICALHRMEIFPIIIHIPINERAAKKLKKALQRLGTSEEQLLEAGKQEEAALDG
APCLYGSLAPDGWSDLEALLGCVRSAIRDEQRKVVWTEQSPR
Download sequence
Identical sequences M3YLA5
ENSMPUP00000012112 ENSMPUP00000012112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]