SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YLF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YLF9
Domain Number 1 Region: 441-501
Classification Level Classification E-value
Superfamily SH3-domain 5.62e-23
Family SH3-domain 0.00054
Further Details:      
 
Weak hits

Sequence:  M3YLF9
Domain Number - Region: 47-104
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00741
Family SNARE fusion complex 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YLF9
Sequence length 507
Comment (tr|M3YLF9|M3YLF9_MUSPF) Abl interactor 1 {ECO:0000313|Ensembl:ENSMPUP00000012166} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ABI1 OC=Mustelinae; Mustela.
Sequence
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQAADKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTVGPENISVPPPSGAPPAPPLPPLLPGNTVI
APGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAPFSAQPHVNGGPLYSQNSIS
IAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPIFDDSPPPPPPPPVDY
EDEEAAVVQYSDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKNDD
GWYEGVCNRVTGLFPGNYVESIMHYTD
Download sequence
Identical sequences M3YLF9
ENSMPUP00000012166 XP_004757698.1.14098 ENSMPUP00000012166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]