SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YLG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YLG3
Domain Number 1 Region: 78-310
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.83e-38
Family PhyH-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YLG3
Sequence length 499
Comment (tr|M3YLG3|M3YLG3_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000012170} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MEAMKSKASCAQNPSCTIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAKVIPPKEWRAR
PTYDDISDILIATPLQQVVSGQAGVFTQYHKKKKAMTVGEYRRLANSGKYQTPPHSGFED
LERKYWKTRLYDSPIYGADISGSLFDENTKEWNLGHLGTIQDLLEQECGVVIEGVNTPYL
YFGMWKTTFAWHTEDMDLYSINYLHFGEPKTWYAVPPEHGQRLERLAKELFPGSARACEA
FLRHKVALISPTVLKDNGIPFSRITQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRW
IDYGKVASQCSCGEARVTFSMDAFVRILQPERYELWKRGQDRAAVDHTEPVAPGGPELSA
WREVRGPGRGTWSLRHLPPRRAPRSSSAAQCGAVPARPSGEPGPTGPQPPTPCAPGPRPS
PGRCGPGRRPREQGAQGAQGPSLQARAKRRILGGAGYPAPYSEAQPFPVDGGWVNKPAPL
SPGLRQAAEASVSGCAPVP
Download sequence
Identical sequences M3YLG3
ENSMPUP00000012170 ENSMPUP00000012170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]