SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YLH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YLH3
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000954
Family Chromo domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YLH3
Sequence length 415
Comment (tr|M3YLH3|M3YLH3_MUSPF) Chromobox 8 {ECO:0000313|Ensembl:ENSMPUP00000012180} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CBX8 OC=Mustelinae; Mustela.
Sequence
MPVHALCAAFRAGVMRRARAFRGGISRIHLVHAFFACISCVLVMHFSPCTHAFSPLHPQG
RMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQ
AKAKAKTYEFRSDSARGIRIPYPGRAPQDLASTSRAREGLRNMGLSPPGSSSSPSSTCRV
EPPRDRDRERERERERERERERERERGASRTEDKPSSPGDSSKKRGPKPRKELLDPSQRP
LGEASDGLGDYLKGRKLDEAPSGAGKFPAGHSVIQLARRQDSDLAQCGVANPSPAEATGK
LAVDTFPARVIKHRATFLEARGQGTMDPGGPRVRHGSGTPGSVGGLYRDMGAQGGRPSLI
ARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR
Download sequence
Identical sequences M3YLH3
ENSMPUP00000012180 XP_004748818.1.14098 ENSMPUP00000012180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]