SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YLH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YLH7
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0003
Family Chromo domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YLH7
Sequence length 491
Comment (tr|M3YLH7|M3YLH7_MUSPF) Chromobox 2 {ECO:0000313|Ensembl:ENSMPUP00000012184} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CBX2 OC=Mustelinae; Mustela.
Sequence
SRHNSWEPEENILDPRLLLAFQKKEHEKEVQSRKRGKRPRGRPRKHTVVSCSRHSKLKEP
DAPSKSSSSSSSSTSSSTSSDEEDDSDLDAKRGPRGRETHPVPQKKAQILVAKPELKDPV
RKKRGRKPLPPEQKAARRPVSLAKALKAARKDLGAPAVKLPPPLSAPAAGLAALKAHAKE
VCGGPSAVATPENLASLMKGMAGSPSRGGISWQSSIVHYMNRMSQSQAQAASRLALKAQT
AGKCGLGLDLKVRTQKGGLGIGSPGSKVPKAPSSGAVEQKGGSAGGPPYVHSSSKGPAAC
LGPQPAPTQELSLQVLDLQSVKNGTAGVGMVARHATASKGVPAASPAAGKSVGGGPAGGS
GAAMPSDGSKSEKLPSRVTALPTSAGKRDCVRGSAAPGSQEGHTASGEGRKAALAAELSA
GEESSSDSDPGSASPPGAKQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESP
TSVGFFSLRHY
Download sequence
Identical sequences M3YLH7
ENSMPUP00000012184 ENSMPUP00000012184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]