SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YMA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YMA8
Domain Number 1 Region: 104-332
Classification Level Classification E-value
Superfamily RNI-like 1.46e-34
Family 28-residue LRR 0.0046
Further Details:      
 
Weak hits

Sequence:  M3YMA8
Domain Number - Region: 436-494
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.00068
Family Coiled-coil dimerization domain from cortexillin I 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YMA8
Sequence length 725
Comment (tr|M3YMA8|M3YMA8_MUSPF) Centrosomal protein 78 {ECO:0000313|Ensembl:ENSMPUP00000012465} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CEP78 OC=Mustelinae; Mustela.
Sequence
MIDSVKLRRDSAADFFSHYEYLCALQDSVPLPSVRACLREGVLDFNADRLRLVDWAPLLS
TLKINKDLPLVSIKSFFQPWLGETGSDRSKVCRSRVPAIRNKDVTFQLCKALKCCLSISS
ALKNLELNGLVLRERDLTALTKGLNKSTSLVHLSLANCPIGDGGLEIICQGIKNSITLKT
VNFTGCNLTWQGADHMAKILKYQTMRRHEEIWAESLRYRRPDLDCMAGLRRITLNCNTLI
GDLGASAFAESLSEDLWLRALDLQQCGLTNEGAKALLKALETNRTLVVLDIRKNPLVDHS
VMKAVIKKVLQNGRSAKSEYQWITSPSVKEPFKTARQKKRTIILGNGRKGKATIRIGLAT
KKPVSNGRKHSLGKECYAPEPLPPGVSGFLPWRTAERAKRSRGFPLIKTRDVYNHLQQSG
FPVTVTVESPSSSEIEEVDDSSESVQEQPEKTSLKQEALEEKLEECLKQLKEERVIRLKA
DKRVSELEHENAQLRNINFSLSEALHAQSLTSMMLDDEGVLGSIENSFQKFHAFLDLLKD
AGLGQFATMAGIDQSDFHLLGRPQMNSTLSSLPKEEKKALEEEKPESKQNPLGQMQNIQV
SICMQSAYNEGTLMKFQKITGDARIPLPLDSFRVPVSTQETLETSRDNLEVPVNEQQQDS
IKEFIARTCSPSADVMSGTGSQRKEDELSRNNRSSSEKMTKTDHRCFSSESTSATLLLHS
QFQKD
Download sequence
Identical sequences M3YMA8
ENSMPUP00000012465 ENSMPUP00000012465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]