SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YMD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YMD5
Domain Number 1 Region: 91-273
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.85e-75
Family T-box 0.000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YMD5
Sequence length 436
Comment (tr|M3YMD5|M3YMD5_MUSPF) T-box 6 {ECO:0000313|Ensembl:ENSMPUP00000012492} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TBX6 OC=Mustelinae; Mustela.
Sequence
MYHPRELYPSLGTGYRLGPPQPGTDSSFPPALAEGYRYPDLDPPKLDCFLSGIEAAPCTL
GAAPPLPPLPPALGTEPAPPAPEALHALPGVSLSLENRELWKEFNSVGTEMIITKAGRRM
FPACRVSVTGLDPEARYLFLLDVVPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPA
TGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGVASFR
FPETAFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPGAAEA
YGSGDAPGGPCDSTLGGDVRESDPEQAPAPREAAPAPAPLCGGSSAEAYLLHPAAFHGAP
SHLPTRNPSFPEAPDSGRPAPYSAAFLELQPGPGGSGYPAAAPPAPFASHFLQGGPFPLA
YPGPGAYLDVGSKPMY
Download sequence
Identical sequences M3YMD5
ENSMPUP00000012492 XP_004774006.1.14098 ENSMPUP00000012492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]