SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YMW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YMW2
Domain Number 1 Region: 100-174
Classification Level Classification E-value
Superfamily DEATH domain 0.00000942
Family DEATH domain, DD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YMW2
Sequence length 193
Comment (tr|M3YMW2|M3YMW2_MUSPF) EDAR associated death domain {ECO:0000313|Ensembl:ENSMPUP00000012669} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=EDARADD OC=Mustelinae; Mustela.
Sequence
MAKEPVEDTDPSTLSFNPSDKYPIQDTGLPKAEECDPITLNCPTESDVQHQGEENSFPDS
TGDPLSDVSKGESCKENCTCPSCSLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNF
ASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRPVGQLMELCRLYHRADVEKVLHRWVDEE
WPKRGRGDHPRNF
Download sequence
Identical sequences M3YMW2
ENSMPUP00000012669 XP_004774857.1.14098 ENSMPUP00000012669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]