SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YMX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YMX6
Domain Number 1 Region: 491-634
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 1.71e-50
Family gamma-adaptin C-terminal appendage domain-like 0.000000113
Further Details:      
 
Domain Number 2 Region: 10-154
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.2e-45
Family VHS domain 0.000000201
Further Details:      
 
Domain Number 3 Region: 172-300
Classification Level Classification E-value
Superfamily GAT-like domain 4.51e-41
Family GAT domain 0.000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YMX6
Sequence length 634
Comment (tr|M3YMX6|M3YMX6_MUSPF) Golgi associated, gamma adaptin ear containing, ARF binding protein 1 {ECO:0000313|Ensembl:ENSMPUP00000012683} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GGA1 OC=Mustelinae; Mustela.
Sequence
MEPAMEPETLEARINRATNPLNKELNWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLY
SWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDATFPLPPPRPKNVIFEDEEKSKMLAR
LLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVSAIEEVNNNVKLLTEMVMSHSQGGA
SARSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVISLYKQLVRG
EEVNGEAAAGSGSLPGSTSALLDLSGLDLPPAGTTYPPMPTRPADPASPEQPSTSVSLLD
DELMSLGLSDPTPPPGPSLDGAGWNSFQSSDGAEPPAPPRVPNTDSQTPLPASSGLDDLD
LLGKTLLQQSLPPESQQVRWEKQQPAPRLTLRDLQNKSNCSSPSSSAPSLLHAASPEPPG
PLQQPTTTDFSLASITVPLESIKPSSILPVTVYDQHGFRVLFHFARDPLPGRSDVLVVVV
SMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEK
VRLRYKLLFTMGDQTYNEMGDVDQFPPPETWGSL
Download sequence
Identical sequences M3YMX6
ENSMPUP00000012683 XP_004743247.1.14098 ENSMPUP00000012683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]