SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YN27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YN27
Domain Number 1 Region: 129-457
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 5.49e-112
Family Rap/Ran-GAP 0.000000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YN27
Sequence length 714
Comment (tr|M3YN27|M3YN27_MUSPF) RAP1 GTPase activating protein 2 {ECO:0000313|Ensembl:ENSMPUP00000012734} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RAP1GAP2 OC=Mustelinae; Mustela.
Sequence
MLASLKVKKQELANSSDVTFPDRPLSPPLTAPPTMKSAEFFEMLEKMQGIKLEEQKPGPQ
KNKDDYIPYPSIDEVVEKGGPYPLIVLPQFGGYWIEDPENVGTPTSLGSSICEEEEEDSL
SPSTFGYKLECRGEARAYRRHFLGKDHLNFYCTGSSLGNLLLSIKCEEAEGIEYLRVILR
SKVKTVHERIPLAGLNKLPSVPQIAKAFCDDAVGLKFNPVLYPKASQMIVSYDEHDVNNT
FKFGVIYQKARQTLEEELFGNNEESPAFKEFLDLLGDTITLQDFKGFRGGLDVTHGQTGV
ESVYTIFRDREIMFHVSTKLPFTEGDAQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASN
FLHAYIVVQAENPGTETPSYKVSVTAREDVPAFGPPLPSPPVFQKGPEFREFLLTKLTNA
ENACCKSDKFAKLEDRTRAALLDNLHDELHSHTQAMLGLGPEEDKFENGGHGGFLESFKR
AIRVRSHSMETMVSSQKKQHSGGIPGSLSGGISHNSMEVTKTTFSPPAASAAAAAKNQSR
SPIKRRSGLFPRLHTGSEGQGDGRTRCDSASSNPKTPDGAHSSQEMKSEASSNPSSPEIC
PNKEKPFIKLKENGRANISRSSSSTSSFSSTAGEGEAMEECDSGSSQPSTTSPFKQEVFV
YSPSPSSENPSLGAAATPIIMSRSPTDPKSRNSPRSNLKFRFDKLSHASSSAGH
Download sequence
Identical sequences M3YN27
ENSMPUP00000012734 XP_012908935.1.14098 ENSMPUP00000012734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]