SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YN33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YN33
Domain Number 1 Region: 459-536,603-785
Classification Level Classification E-value
Superfamily RNI-like 2.75e-24
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YN33
Sequence length 816
Comment (tr|M3YN33|M3YN33_MUSPF) Leucine rich repeat containing 41 {ECO:0000313|Ensembl:ENSMPUP00000012740} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LRRC41 OC=Mustelinae; Mustela.
Sequence
MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPSAPPALFELCGRAVSAHMGV
LESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLES
VTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELV
AEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPES
ALFILILTMSAGFWQPGPGGPPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAA
LMASRRKSEAKQIARAAPATRVTRRSTQESLTAGGTDPKRDLHPPATSHEAPGTKRPSSA
PATSSSASASSSTSSSKRAPASSAPQPKPLKRFKRATGKKGPRTRQGSGAESEDLYDFVF
IVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAAL
TLCHLLSSWVSLESLTLSYNAIGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPI
LELTRAIVRALPLLRVLSIRVDHPSQRDNPAVPGNAGPPSHIIGDEEIPENCLEQLEMGF
PRGAQPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEYNLALKRLSFHDMNL
ADCQSEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKGNSTLKGLRLPGNRLGN
AGLLALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQ
DAVTAREAIRRLRATCHVVSDSWDSSQAFADYVSTM
Download sequence
Identical sequences M3YN33
ENSMPUP00000012740 ENSMPUP00000012740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]