SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YN73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YN73
Domain Number 1 Region: 531-928
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.57e-116
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 200-306
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-24
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Weak hits

Sequence:  M3YN73
Domain Number - Region: 385-438
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0366
Family DNA-binding N-terminal domain of transcription activators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YN73
Sequence length 928
Comment (tr|M3YN73|M3YN73_MUSPF) Oxysterol-binding protein {ECO:0000256|RuleBase:RU003845} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=OSBP2 OC=Mustelinae; Mustela.
Sequence
MGKAAALCRGSGCGGRSRGLSSLFTVVPCLSCHTAAPTMSVSTPGPGPEPKPQPKPQPKP
PPQPVPKPERQPGSEEVPEPLSEPVPRLEPVSEKTSEPRPESRQGTELLLGLGRGSGPRP
ELGSSIGAGTCPKASSEQLPALGSVVGSAPWTKPELGSLAVSKPPPLLRPGQAKASLGVP
MSGTGTTFTAPKVLLPLDSFKGWLLKWTNYLKGYQRRWFVLSNGLLSYYRNQGEMAHTCR
GTINLSTAHFDTEDSCGIVLTSGARTYHLKASSEVERQQWITALELAKAKAVRMMSSHSD
DSGDDDDETASPADKSELHCTIQSLSLKLDDLSTCNDLIAKHGAALQRSLSELDGLKIPY
ESSEKLKAVNERATLFRITSNAMINACRDFLELAETHSRKWQRALQYEQEQRIHLEETIE
QLAKQHNSLERAFRSAPGRATNPTKSFSEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFIT
VITEAKEDRKAEGGTTGPVDWTSSDNVLDGASLVPKGPPKVKRRVRIPDKPNYSLNLWSI
MKNCIGRELSKIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVS
SYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQE
ITISSKFRGKYLSIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQTGDIEIVN
HKTQDRCQLKFLPYSYFSKEVARKVTGVVSDSQGKAHYVLSGSWDEQMECAKIVQSSPSS
PSSDGKQKTVYQTLPAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQ
RLMEKGHWDEANTEKQRLEEKQRLSRRRRLEACSRGCGTEEEKEADVYMPLWFEKRLDPL
TGETACMYKGGYWEAKERQDWHMCPNIF
Download sequence
Identical sequences M3YN73
ENSMPUP00000012780 ENSMPUP00000012780 XP_012918908.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]