SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YNI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YNI0
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000254
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 2 Region: 647-709,768-985,1061-1213
Classification Level Classification E-value
Superfamily ARM repeat 0.00000121
Family MIF4G domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YNI0
Sequence length 1879
Comment (tr|M3YNI0|M3YNI0_MUSPF) Dedicator of cytokinesis 2 {ECO:0000313|Ensembl:ENSMPUP00000012887} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DOCK2 OC=Mustelinae; Mustela.
Sequence
MAPWRKTDKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLLKHKMLQGIFP
KSFIHIKEVTVEKRRNIENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFMQVQSM
MYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRDDDGNILDPDNTSV
ISLFHAHEEATDKITERIKEEMSKDQPDYGMYSRISSSPTHSLYVFVRNFVCRIGEDAEL
FMSLYDPNKQTVISENYLVRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIYLICQIV
RVGKMDLKDTNTKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVTAENDFL
HSLLSKVTASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG
DVRNDIYITLSQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGDKPMNEYRSVV
YYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGT
TLQDGPHDLVVLKGESKKMEDASAYLTLPSYRHHMENKGATLSRSSSSVGGLSVSSRDVF
SISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVKFLQDTLDALFNIM
MEHSQSNEYDILVFDALIYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYKKLMTVLKTY
LDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESMRRLFESINNL
MKSQHRTTILLQVAALKYIPSVLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN
EIVQSNLFKKQECRDILLPVITKELKELLEQKDEMQHQVQEKKYCVELLNSILEVLSCQD
AAFTYHHIQEIMVQLLRTVNRTVITMGRDHVLISHFVACMTAILNQMGDQHYSFYIETFQ
TSSELVDFLMETFIMFKDLIGKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTN
FEFQLWNNYFHLAVAFITQDSLQLEQFSHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQN
KICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRSGDFKKFENEIILKLDHEV
EGGRGDEQYMQLLESILMECAAEHPTIFKSVENFVNLVKGLLEKLLDYRGVMADESKDNR
MSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCENYTEAAYTLLLHTWLLKWSDEQCAS
QVMQTGQQHSQTHRQLKETLYEIIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQ
NLIQQAKFYENIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMS
QFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQ
KFHYSRPVRKGTVDPENEFASMWIERTSFITAYKLPGILRWFEVVHMSQTTISPLENAIE
TMSTANEKILMMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYTRDHP
EDQEKLSRLKDLIAWQPHQGCPDLPCYKTKLRPPFSLQPFCPSIRQLLAFLLSLCIAQSF
LRKLYIPFLGAGIKIHEKRVSENLRPFHDRMEECFKNLKVKVEKEYGVREMPDFEDRRVG
RPRSMLRSYRQMSIISMASMNSDCSTPSRTTSESFDLELATLKTPKAEPVEMISVGSTLP
EVKLRRSKKRAKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAAIPPRASILSQM
SFASQSMPTIPALTLSVAGVPGIEDSSSSPRLSQTFFPLSDGDKKTLKRKKVNQFFKTML
ASKSAEEGKQIPDILSSDL
Download sequence
Identical sequences M3YNI0
ENSMPUP00000012887 ENSMPUP00000012887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]