SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YNQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YNQ9
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-64
Family IMD domain 0.0000304
Further Details:      
 
Weak hits

Sequence:  M3YNQ9
Domain Number - Region: 374-408
Classification Level Classification E-value
Superfamily SH3-domain 0.00965
Family SH3-domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YNQ9
Sequence length 523
Comment (tr|M3YNQ9|M3YNQ9_MUSPF) BAI1 associated protein 2 like 2 {ECO:0000313|Ensembl:ENSMPUP00000012966} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BAIAP2L2 OC=Mustelinae; Mustela.
Sequence
MAPEMDQFYRSTMAIYKSITDQFNPALENLVYLGNNYLRAFHALSQAAEVYFNAIQKIGE
QALQSSTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHMEKNTKLDMQFIKDSRQ
HYEREYHHRATNLEKYMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEE
KRRYRFLAEKHLLLSNTFLQFFGRARGVLQNRVLLWKEQSEASRSPSRAHSPGLLGPVLG
PPYPSGRLTPTRLDMPPRPLAEFSSPRSRHGAGSSQAEFQSGAGKSLQDCKLGLVLTPGG
EAGGGEEESTGAHEGDRKDGGGGQWAGHSRPFLVRAEVKHKEMVLFPGAALGSAAVTTVS
GPFVYGPLCLHPLRSGWFPEAYVKPLEEVPVSPINPLNPVTSMNPMSPMNELPSRSYPLR
GSHSLDDLLDRPGNSTAPSEYWDGQSRSRTPTRIPSRAPSPAPTPLPDSRRSSMGSPGVA
SDVKKLMSWEQQPPELFPRGTNPFATVKLRPTVTNDRSAPLIR
Download sequence
Identical sequences M3YNQ9
ENSMPUP00000012966 ENSMPUP00000012966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]