SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YNU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YNU9
Domain Number 1 Region: 9-214,260-370
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.69e-54
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YNU9
Sequence length 372
Comment (tr|M3YNU9|M3YNU9_MUSPF) Parvin alpha {ECO:0000313|Ensembl:ENSMPUP00000013006} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PARVA OC=Mustelinae; Mustela.
Sequence
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLP
LSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLA
EDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVD
SVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEA
LSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRV
LYNLFTKYRNVE
Download sequence
Identical sequences A0A096NAM4 A0A0D9QXB3 A0A287B7K9 A0A2J8UQ07 A0A2K5NL57 A0A2K6AMG8 A0A2K6Q8E4 F6T6X4 I3M4P3 M3YNU9 Q9NVD7 U6CR38
ENSGGOP00000014295 XP_003781157.1.62490 XP_004752054.2.14098 XP_005578653.1.63531 XP_010369624.1.97406 XP_011748306.1.29376 XP_011809661.1.43180 XP_011937221.1.92194 XP_014699647.1.49734 XP_017737070.1.44346 9606.ENSP00000334008 ENSPANP00000009759 ENSCJAP00000019069 ENSMPUP00000013006 ENSMPUP00000013006 ENSP00000447198 ENSCJAP00000019069 ENSGGOP00000014295 ENSSTOP00000004200 ENSSTOP00000004200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]