SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YP91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YP91
Domain Number 1 Region: 6-61
Classification Level Classification E-value
Superfamily Chromo domain-like 1.37e-18
Family Chromo domain 0.00098
Further Details:      
 
Weak hits

Sequence:  M3YP91
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily Fibronectin type III 0.071
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YP91
Sequence length 251
Comment (tr|M3YP91|M3YP91_MUSPF) Chromobox 7 {ECO:0000313|Ensembl:ENSMPUP00000013148} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CBX7 OC=Mustelinae; Mustela.
Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPALPFPLRKPRKAHKYLRLSRKKFPPRGPDLESHSHPRELFLQEPAAP
DVLQAASEWEPAEQPPEEEADGDLAEGPPPWTPVLPPSEVTVTDITANSVTVTFREAQAA
EGFFRDRGGKF
Download sequence
Identical sequences M3YP91
ENSMPUP00000013148 ENSMPUP00000013148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]