SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YPB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YPB6
Domain Number 1 Region: 50-237
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.08e-52
Family Tpt1/KptA 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YPB6
Sequence length 274
Comment (tr|M3YPB6|M3YPB6_MUSPF) tRNA phosphotransferase 1 {ECO:0000313|Ensembl:ENSMPUP00000013174} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TRPT1 OC=Mustelinae; Mustela.
Sequence
MGGLLRLGRRGRCDASELDFAMNSRGGRRQETTGSRGRRAHRPRGQDQDVQLSKALSYVL
RHGALKLGLPMRADGFVPLGTLLQLPQFHGFSAEDVQRVVDTNEKQRFALQPGDPGTGPL
IRANQGHSLQVPELELMPLETPQALPLRLVHGTFWQHWPSILLNGLSCRGRTHIHLALGL
PGDPGVISGMRPNCEVAVFIDGPRALADGIPFFRSANGVILTPGNADGFLLPKYFKEALQ
LRPTRKSLSLAGNEETEYQSGPKHSSRGSRMTQQ
Download sequence
Identical sequences M3YPB6
ENSMPUP00000013174 ENSMPUP00000013174 XP_004770241.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]