SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YPG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YPG3
Domain Number 1 Region: 648-744
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-22
Family PWWP domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YPG3
Sequence length 755
Comment (tr|M3YPG3|M3YPG3_MUSPF) PWWP domain containing 2A {ECO:0000313|Ensembl:ENSMPUP00000013221} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PWWP2A OC=Mustelinae; Mustela.
Sequence
MAAGAAEAAATAASPGEGGAGEAEPEMEPIPGSEAGTDPLPVTATEASVPDGEADGQQSS
PQADEPPLPPPPPPPGELARSPEAAGPELEAEEKLPARVAEPAAAAPQERPDLPPSPAPP
PEQPPAPEERQEPPLPQPAAPALVPPAGGDSAVSQLIPGSEVRVTLDHIIEDALVVSFRL
GEKLFSGVLMDLSKRFGPHGIPVTVFPKREYKEKPEAMQLQSNTFQEGTEVKCEVNGAVP
DDPSPISPPEPGLAESLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPPRKIKRPKRK
MYREEPTSIMNAIKLRPRQVLCDKCKTGVVAEKKEIRKGSSASDSSKYEDKKRRNESVTT
VNKKLKTDHKVDGKNQNESQKRNAVVKVSNIAHSRGRVVKVSAQANTSKAQLSTKKVLQS
KNMDHAKAREVLKIAKEKAQKKQSETSTSKNAHSKVHFTRRYQSPSSGSLPPRVRLKPQR
YRNEENDSSLKTGLEKMRSGKMAPKPQSRCTSTRSAGEAPSENQSPSKGPEEASSEVQDT
NEVLVPGEQDEPQTLGKKGSKSNLSVYMTLNQKKSDSSSASVCSIDSTDDLKSSNSECSS
SESFDFPPGSMHAPSTSSTSSSSKEEKKLSNSLKMKVFSKNVSKCVTPDGRTICVGDIVW
AKIYGFPWWPARILTITVSRKDNGLLVRQEARISWFGSPTTSFLALSQLSPFLENFQSRF
NKKRKGLYRKAITEAAKAAKQLTPEVRALLTQFET
Download sequence
Identical sequences M3YPG3
XP_004737754.1.14098 ENSMPUP00000013221 ENSMPUP00000013221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]