SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YPK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YPK7
Domain Number 1 Region: 236-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.77e-17
Family TRASH domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YPK7
Sequence length 1295
Comment (tr|M3YPK7|M3YPK7_MUSPF) Zinc finger MYM-type containing 2 {ECO:0000313|Ensembl:ENSMPUP00000013265} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZMYM2 OC=Mustelinae; Mustela.
Sequence
MDTGSVGGLELTDQTPVLLGSTAMATSLTNVGNSFSGPPNPLVARSNKFQNSSVEDDDDV
VFIEPVQPPPPSAPVVTDQRTVTFSSSKNEELQGNDSKILPSSKELASQKGSVSETIVID
DEEDMETNQGQEKNSSNFIERRPPETKNRTNDVDFPTSSFSRSKTKTGVGPFNPGRMNVA
GDVFQNGESATHHNPDSWISQSASFPRNQKQPGVDSLSPVASLPKQIFQPSAQQQQQQQQ
PTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKPAPKKLCVMCKKDITT
MKGTIVAQVDSSESFQEFCSTSCLSLYEDKQNPTKGALNKSRCTICGKLTEIRHEVSFKN
MTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGNNVLVIDGQQKRFCCQSCVSEY
KQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCRTQCRFFDMTQCIGPNGYMEPYC
STACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMPDGKLYNFCNSSCVAKFQALSMQ
SSSNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVHQFCSKTCSDDYKKLHCIVTYCE
YCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRLGLRCVTCNYCSQLCKKGATKEL
DGVVRDFCSEDCCKKFQDWYYKAARCDCCKSQGTLKERVQWRGEMKHFCDQHCLLRFYCQ
QNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPTPNKEMKNKAVLCKPLTMTKATY
CKPHMQTKSCQTDDNWKTEYVPVPIPVPVYIPVPMHMYSQNIPVPTTVPVPVPVPVFLPA
SLGSSEKIPAVAEELKSKVSSDPLDTELLTMTDMMTEDEGKTEAANINSVIIETDIIGSD
LLKNSDPETQSNMPDVPYEPDLDIEIDFPRAAEELDMENEFLLPPVFGEEYEEQPRPRSK
KKGAKRKAVSGYQSHDDSSDNSECTFPFKYTYGVNAWKHWVKTRQLDEDLLVLDELKSPK
SVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGESYAPDSIYYLCLGIQEYLCGSNRKDNI
FIDPGYQTFEQELNKILRSWQPSILPDGSIFSRVEEDYLWRIKQLGSHSPVALLNTLFYF
NTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRK
HEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQNLNQRMDVFYLQPECSSSTDSPVWYT
STSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD
Download sequence
Identical sequences M3YPK7
ENSMPUP00000013265 XP_012904275.1.14098 ENSMPUP00000013265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]