SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YPM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YPM6
Domain Number 1 Region: 70-183
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-23
Family PDZ domain 0.0051
Further Details:      
 
Domain Number 2 Region: 212-285
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-20
Family PDZ domain 0.0000938
Further Details:      
 
Domain Number 3 Region: 740-841
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.00000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YPM6
Sequence length 939
Comment (tr|M3YPM6|M3YPM6_MUSPF) USH1 protein network component harmonin {ECO:0000313|Ensembl:ENSMPUP00000013284} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=USH1C OC=Mustelinae; Mustela.
Sequence
KAVIRHYSHHQVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPSRLPLFDA
IRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFSCGLFISHLIKGG
QADNVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIKVRHIGLIPVKSSPEEPLK
WQYVDQFVSESGGGRSSLAFPGSRENKEKKVFISLVGSRGLGCSISSGPVQKPGIFISNV
KPGSLSAEVGLETGDQIVEVNGIDFSNLDHKEAVNVLKSSRSLTISIVAGAGRELFLTDR
ERLEEARQRELQRQELLMQKRLAMESNKILQEQQEMERQRKKEIAQKAAEENERYRKEME
QIIEDEEKFKKQWEEDWGSKEQLLSPKTITAEVHPVPLRKPKSFGWFYRYDGKFPTIRKK
GKDKKKAKYDSLQELRKNKKELEFEQKLYKEKEEMLEKEKQLKINRLAQEVSETEREDLE
ESEKIQYWVERLCQTRLEQISSADNEISEMTTGPPPPPPSVSPLVPPLRRFAGGLHLHTT
DLDDIPLDMFYYPPKTPSALPVMPHPPPSTPSPKVPAPPVLPSSGHVCASSSPWVQRTPP
PIPIPPPPSVPTQDLTPTRPLPSALEEALGNHPFRAGDTGNPTEDWEAKNHSGKPTSSPV
PERSFPPTPKTFCPSPQPPRGPGVSTISKPVMVHQEPNFIYRPAVKSEVLPQEMLKRMVV
YQTAFRQDFRKYEEGFDPYSMFTPEQILGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVV
SAVYEGGAAERHGGIVKGDEVMAINGKIVTDYTLAEAEATLQKAWSQGGDWIDLVVAVCP
PKEYDDELSALPSSAAESPHVRKVLEVRAPMPRHGFLLQLEPDDLLLKPRRRNHIHPEKP
VSSGFTLLNTKPRPSLESQLAGPLETYSQHPRISSSPWP
Download sequence
Identical sequences M3YPM6
ENSMPUP00000013284 ENSMPUP00000013284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]