SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQ82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YQ82
Domain Number 1 Region: 228-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YQ82
Sequence length 478
Comment (tr|M3YQ82|M3YQ82_MUSPF) Transcription factor EB {ECO:0000313|Ensembl:ENSMPUP00000013491} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TFEB OC=Mustelinae; Mustela.
Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQALGGPPTPAISTPVHFQ
SPPPVPGEVLKVQSYLENPTSYHLQQSRDQKVREYLSETYGNKFAAHISPAQGSPKPLPA
ASPGVRAGHVMSSSAGNSAPNSPMAMLHIGSNPEREFDVIDNIMCLDDVLGFINPETQMP
NTLPLSSSRLNVYSGDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHN
LIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENH
SRRLEMTNKQLLLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALL
LEAEVPDPEPLPVLPPQAPLPLPAQPPQPPSPFHHLDFSHSLSFGGGGDEGPPGYPEPLG
PEHGSPFPNLSKKDLDLMLLDDSLLPLASDPLFSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences M3YQ82
ENSMPUP00000013491 XP_004739991.1.14098 XP_012917853.1.14098 ENSMPUP00000013491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]