SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YQD3
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000425
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 7.59e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 429-489
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000034
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YQD3
Sequence length 501
Comment (tr|M3YQD3|M3YQD3_MUSPF) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSMPUP00000013542} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=WAS OC=Mustelinae; Mustela.
Sequence
MSGGPVGGRSGGRGGPGVQQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQTGRLLWEQELYSQLVYSTPTPFFHTFAGD
ACQAGLNFADEGEAQVFRALVQEKIQKRNQRQSGDRRQLPPPPAPANEERRGGLPPLPPH
PGGDQGGPASGQLSLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQAPRPPTMGSNKGRSGPLPPVPLGGAPPPPTPRAPP
PPGRGGPPPPPPPATGRSGPPPPPPPGAGGPPVPPPPPPPPPPPSSGDGPVPPPPPALGP
VGNLAPGGGRGALLDQIRQGIQLNKTPGAPENSALQPAPQSSEGLVGALMHVMQKRSRAI
HSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences M3YQD3
XP_004755083.1.14098 ENSMPUP00000013542 ENSMPUP00000013542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]