SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YQE1
Domain Number 1 Region: 196-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-87
Family Protein kinases, catalytic subunit 0.0000000000142
Further Details:      
 
Domain Number 2 Region: 47-193
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.91e-40
Family Regulator of G-protein signaling, RGS 0.000000366
Further Details:      
 
Domain Number 3 Region: 563-671
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-24
Family Pleckstrin-homology domain (PH domain) 0.0000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YQE1
Sequence length 697
Comment (tr|M3YQE1|M3YQE1_MUSPF) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GRK3 OC=Mustelinae; Mustela.
Sequence
MPRDTCNRTCRGNPSDLPLQELMKSWGRRRGVRDPTWILEDRQEVCSIRSVMQKYLQERN
EITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLENEEDRLCRSRQIYDT
YIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGNIFQKFMESDKF
TRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQ
GETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSE
KEMRFYATEIILGLEHMHSRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASV
GTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNV
ELPEAFSPELRSLLEGLLQRDASKRLGCHGGGAQEVKEHIFFKGIDWQQVYLQKYPPPLI
PPRGEVNAADAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLVISERWQQEVAETVYEAVNA
DTDKIEARKRAKNKQLGHEEDYALGRDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWR
GEGESRQNLLTMEQILSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTETF
TEAQRLLRRAPKFLNKSRPGVVELSKPPLCHRNSNGL
Download sequence
Identical sequences M3YQE1
ENSMPUP00000013550 ENSMPUP00000013550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]