SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YQE4
Domain Number 1 Region: 249-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-19
Family Erythroid transcription factor GATA-1 0.00012
Further Details:      
 
Domain Number 2 Region: 201-247
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000095
Family Erythroid transcription factor GATA-1 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YQE4
Sequence length 414
Comment (tr|M3YQE4|M3YQE4_MUSPF) GATA binding protein 1 {ECO:0000313|Ensembl:ENSMPUP00000013553} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GATA1 OC=Mustelinae; Mustela.
Sequence
MEFPGLGALGTSEPLPQFVDPALVSSPPESGVFFSSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYASWTYSKTGLYPAAAVCPTREDSPPQA
PEDPDGKGGSSFLETLKTERLSPDLLTLGPALPSSIPVPSSAYGGPDFSSTFFSPTGSPL
NPAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEMASGLTLGPPST
AHLYQGLGPVVLSGPVSHLVPFPGPLLGSPTGSFPAGPVPPTTTTTTVVAPLSS
Download sequence
Identical sequences M3YQE4
XP_004755084.1.14098 ENSMPUP00000013553 ENSMPUP00000013553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]