SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YQV1
Domain Number 1 Region: 112-214
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-26
Family PDZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YQV1
Sequence length 328
Comment (tr|M3YQV1|M3YQV1_MUSPF) MAGI family member, X-linked {ECO:0000313|Ensembl:ENSMPUP00000013710} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MAGIX OC=Mustelinae; Mustela.
Sequence
MEPRARGATDPRGSRGGRDLPLQSGPRARQLLARLDARPLAARAAADVAALVRRTGATLR
LRPKAAVSVLDSADIEVTDSRLPNPTFVEHRPQHHRSVTLGTGTAPPQVTRSKACSASKL
LQTSGRFCVELVRDSTGFGLTLSGGQDSSGDAPLAVRGLLRNGPAQRCGRLQAGDLVLHI
NGESTRGLTHAQVVERIRTGGPRLRLVLRRPLESHPGEPEGAGGPEKGDGLPSPDRSPDP
GGPEVVRSHTVSASPLPHRRGSPEPSPEPLADCPAVPPPQRRTDDPNDRTPGSPGPWLVP
SEERLSRALGIPGAPQLALEMVAGRRRH
Download sequence
Identical sequences M3YQV1
XP_004755141.1.14098 ENSMPUP00000013710 ENSMPUP00000013710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]