SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YQX5
Domain Number 1 Region: 2-717
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.33e-189
Family Motor proteins 0.0000000261
Further Details:      
 
Domain Number 2 Region: 1623-1711
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000139
Family SH3-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YQX5
Sequence length 1742
Comment (tr|M3YQX5|M3YQX5_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000013734} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
DSSALLCLKKRFHLGRIYTFGGPLLLSLNPHRPLPLFSAEVLASYHPKRAPNTTPHILAI
AASAYDRLSRSSGQGTCILLGGHSGSGKTEAARKIVQFLSSLEQEQTRDRRCHLDGVLPV
LSSFGHAKTVLNANASRFGQVFCLCVQNGVIVGASVSHYLLETSRVVFQAQAERSFHVFY
ELLAGLDPAEREKLSLQGPETYSYLNQGQACCLQGKDDARDFEGLRKALQVLCPEEVTAA
WAVLAAVLHLGNICFSSSERESQEVAAVSSWAEIHAAARLLLVPPECLEGAVTRRVTETP
YGWVCRSLPVESAVDARDALAKALYSRLFTWLLERSNAQLAAPGEGEHVDTITVVDVYGF
EALRVNGLEQLCNNLASERLQLFSSRLLWAQEEEACRRELLAWVPVPQPVWDTCLDLLVD
QPHSLLRLLDAQTWLPQATDHTFLQKCHYHHGSHPCYSKPQLPLPIFTVRHCAGTVTYQV
HKFVNRNRDHLDPAAVAMLAQSQLQVPLPALSEPPPLHTVSPHLPESQSTAGPDKPTLAS
RFQHSLEDLLARLGRSHVYFIQCLTPNPGKLPGLFDVGHVAEQLHQAGILEAVRTRSANF
PVRLPFQAFLARFRALETEAQGESSDRERCGAILSHVLGAESPLCHLGLERVLLREPGWQ
QLEQHRAQRRSQALLALHGSLRTCISRQRLSRLLLPQMQARVRGLQARKRYLRRRAALGQ
LSTVLLVARPLLRRRQRLQELGRLEIPAEVAVLLKTAEGHHHALDGSITESMPPEVPART
SLSLPPDIDQFPFSSFISTNFQEPALPSPGQLLAEPLTRLHGENPQHALDINKVMLRLLG
DGTLLPWQEQSMGEYLVRQGQRRPGLRDEIFSQLVAQIWHNPDEQQTQRSWALMAILLSA
FPPMPPLQKPLLKFVSDQAPTGMAALCQHKLLGALEQAHLAPGMARAHPPTQLEWTAGRR
RGRMALDIFTFNEECYSAEVESWTTGEQFAGWILQSRGLELPPRGWSVSLHSGDSWQDLV
GCDFVLDLIGQTEDLGDPVSPHSYPIAPRGLLDTTPIQGTPLAGPTVSHRDEDIAPAPGI
QAPSLPDPPPGPAPALPSRIQSGKARMGTVRLPVCPIGESQNSGNLDGFLDHLFQPVLSP
GHRDLEQAWALSSRLKGGGAVGPMRQGSYPMAMVMPPQPPPAPQPLLPSVDPRQLAAQQQ
SFINQQALLLAQQMTTQAMTLSLEQQTQWRWRQAQPQAQAPGAASPTSPPPVAPKPKKPL
ALQREPEREVESSVPSPPPPRVVTSAPTQGRVKAAQEAEAKPAAQRAGPGGHPAPAPHQR
AEPSREIRNIIRMYQSRPGPVPMPVQPARKPPKNFLKKNNPKDEALGPSPRGMASHLGGP
GLSGTQLRTCFVPPQTPSPSPGKGPAPAVAPRPKFPPQKPLRAQRYKLLVPSGSVCFSYL
NPSWRLFLRKEVFYPRENFSHPYCLRLLCEQILKDTFAESCVRISQEERSKMKELLGHLE
VGLESLSTTEDSVKKRIVVAARDKWANYFSRIFPVSGESGSDVQLLGVSHRGLRLLKMTK
GPSLHPSQLKTLCSYSFAELLGVECLGRSTLELTLKSEQLVLHTARASAIKAMIELFLSE
LKKDSGYVIALRSYITDDHSLLSFHRGDLIKLLPVATLEPGIPGGGQGSRHGEGSTWPSR
GRAEGPGWQFGSTGGRSGLFPADIVQPAAAPDSSFSPERSGRRKSRLQPREPGLAQWERA
AE
Download sequence
Identical sequences M3YQX5
ENSMPUP00000013734 ENSMPUP00000013734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]