SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YQY8
Domain Number - Region: 133-247
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0398
Family Arfaptin, Rac-binding fragment 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YQY8
Sequence length 593
Comment (tr|M3YQY8|M3YQY8_MUSPF) Coiled-coil domain containing 36 {ECO:0000313|Ensembl:ENSMPUP00000013747} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CCDC36 OC=Mustelinae; Mustela.
Sequence
MNFNVWNIKEMLSIPSGSGTTKSSSWNNNQADYSSLSDSQFLFGSQFCPESSETLSAPLD
GVHVRHPKQSQQNSLDSEPSIFTKYQTKPPLFGADANDRGLFPPPLSVGKAKGLLEQFEE
KKKRAKDKCDSETLYNLISHIRESIHRLQTSVEKSEEHLSSRSQSILDGLETLAKTLQET
VRAQSDLVLETVHDKGNMEQVIFEIQKRFEARQAEFIEMRSDLKHLEALVAQQSKDFQQL
CEQLGQLNVASVLAELKRLISDPRVAGHVKDSTSQTSPPLAQSLHFTRQGRYASEEAVLW
PAQAPAAVRTRSMGSLQPGEFGVCGERAESGALQEEAMRQAAGTSRSNRRVKDRAVQTNR
RNWTGPKTSSENHGAGSPGPEVLGGKDWVSPGASRLLPLDSNKFAASIKNTCPKCQAAGV
SPCDPREQRLVTAQKSRPVERGRKGRKQAPRKSQRGRLRARKQEQAPSKTCAVIPKYPQP
PVSGPQSPPLEQQKPRAQPLHLWGPNSPTKPVSAILGGRVMRTKAVRAAQGDLLELSGLS
SQDNSLLATSSQGDHQMSWFSDLNLGSSDPPVCKEPGKSMLYDLGFDSSDDGF
Download sequence
Identical sequences M3YQY8
ENSMPUP00000013747 XP_004760729.1.14098 XP_004760731.1.14098 XP_012916200.1.14098 XP_012916201.1.14098 ENSMPUP00000013747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]