SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YQY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YQY9
Domain Number 1 Region: 66-397
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.83e-111
Family Rap/Ran-GAP 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YQY9
Sequence length 993
Comment (tr|M3YQY9|M3YQY9_MUSPF) GTPase activating Rap/RanGAP domain like 3 {ECO:0000313|Ensembl:ENSMPUP00000013748} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GARNL3 OC=Mustelinae; Mustela.
Sequence
MKSSVSEDLGCRRGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATALPGTW
RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAIL
WRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVN
FKFGVLFAKDGQLTDDEMLSNEIGSDAFQKFLNLLGDKITLKGWTGYRGGLDTKNDTTGT
HSVYTVYHGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGEEPSPAFKPSMI
RSHFTHIFALVRYDQQNDNYRLKIFSEESVPLFGPPLPSPPVFTDHQEFRDFLLVKLING
EKATLETPTFAQKRRRTLDMLIRSLYQDLMPDLHKNMLNRRSFSDVLPESPKSARKKEEA
RQAEFVRIGQALKLKSIVRGDAPSSLVASGICKKEPWEPQCFCSDFPYEAVCADPWGQAL
LVSTDAGVLLVDDDLPSVPVFDKTLPVKQMHVLETLDLLILRADKGKDARLFVFRLSAVH
KAIESKQPVKSRCDCRDNKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPG
GLAGISLLSPLSESPVEEFQYIREICLSDSPAVMTLVDGPTEESDNLICVAYRHQFDVVN
ESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSA
SDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFT
ATTAVNEVSSGGSSKGASAHNSPQTPPGRDTPVFPSSLGEGETPSKNLYKIPLRNLVGRS
IERPLKSPLVSKAVTPPTAIGLGIAAIPVTHSLSLSRMEIKEIASRTRRELLGLSDEAGP
RSEGAPKPKSKARKQLEESQGGPKPGTARSTSSDRITTASLESPSAPEANPEGRYHSTGS
DQDPVADREGSPVWGSSPFQLTASSDEDIIDLK
Download sequence
Identical sequences M3YQY9
ENSMPUP00000013748 XP_004757335.2.14098 ENSMPUP00000013748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]