SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YR25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YR25
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 5.89e-28
Family BTB/POZ domain 0.0069
Further Details:      
 
Domain Number 2 Region: 309-385
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000706
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YR25
Sequence length 390
Comment (tr|M3YR25|M3YR25_MUSPF) BTB domain containing 9 {ECO:0000313|Ensembl:ENSMPUP00000013784} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BTBD9 OC=Mustelinae; Mustela.
Sequence
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDW
IRVIDHSQYLCRSWQKLYFPARVCRDVFSI
Download sequence
Identical sequences M3YR25
ENSMPUP00000013784 ENSMPUP00000013784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]